|
|
Build Your Online Product Catalogs?
| Product Name: |
Custom peptide Senolytics and FOXO4-D-Retro-Inverso(DRI)
|
| Supply Ability: |
|
| Related proudcts |
foxo4, |
| Specifications |
Plastic bottle, 10mg/bottle, 20mg/bottle |
| Price Term: |
CIF |
| Port of loading: |
Chengdu |
| Minimum Order |
30mg |
| Unit Price: |
|
|
FOX 04DRI / Senolytics
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
|
| Company: |
Chengdu Youngshe Chemical Co.,ltd
|
| Contact: |
Ms. Cecilia Jiang |
| Address: |
Jitai RD |
| Postcode: |
610000 |
| Tel: |
+86-18108235634 |
| Fax: |
86-028-62328193 |
| E-mail: |
|
|
|
|
Home
